PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011100677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 1020aa    MW: 114131 Da    PI: 7.3662
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011100677.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-40179256178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C+adl++ak+yhrrhkvC +h+ka+ +lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  XP_011100677.1 179 VCQVEECKADLTNAKDYHRRHKVCAMHAKATRALVGNIMQRFCQQCSRFHGLQEFDEGKRSCRRRLAGHNKRRRKTHP 256
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.2E-32173241IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.71177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-37178259IPR004333Transcription factor, SBP-box
PfamPF031106.8E-29180253IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.8E-9790911IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.207.3E-8802920IPR020683Ankyrin repeat-containing domain
CDDcd002047.11E-7802923No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1020 aa     Download sequence    Send to blast
METKFGGKLH HFYGPVVSDL KDVGKKSMEW DLNDWRWDGD LFMAAPLNTV TSDCRSRQLF  60
PVGSNISVNE GASLNTVPSD CRSRQLFQVG SNIRVNSGAS NCSLLWSEEV MGSEKEKRDL  120
EKRRRVFEVE NEQVNEEAGS LNLKLGGQVY PIVEGELDEL EGKSGKKTKV TGAPSSHAVC  180
QVEECKADLT NAKDYHRRHK VCAMHAKATR ALVGNIMQRF CQQCSRFHGL QEFDEGKRSC  240
RRRLAGHNKR RRKTHPDNLV NAATQSDEQG SNYLLISLLR ILSNIHSNNS DQTKDQDLLS  300
HLLRNLAPTG LTNEGNPARP LPVSEDLQNV ETSLATAVED LITPAEPGVT IPTTDLTQKR  360
MLTDKALGKV TYSEPTSQYA IQFPANASDS MKENTSDTTI GRNKLNNFDL NYVYDGSQDC  420
MDNLPDACAS EYLGNMSPAG PLWLYKDSQQ SSPPHNSGNS GSTSSHSPST SSGEAQSRTD  480
RIVFKLFGKD PNDFPLVLRK QILDWLSNSP TDMESYIRPG CIILTIYLRM DKSSWDKLHC  540
DLTSSLRRLV NSSSDSFWRT GWIYTRVQHR VTFVCNGEVV LDTPLPMKNH HSCRISSIKP  600
IAVTVSEGVQ FVVKGFNLSC STSRLLCTME GKYLVQENCA DMTGLADSFI KHDEIQSLSF  660
SCVIPNIVGR GFIEVEDHGL RSSFFPFIVA EEDVCSEICT LESILEDADE DINKLEVRNQ  720
ALDFIHEMGW LLHRSRLKFR LGDSSGDVDL FPFKRFRWLI EFAVDRDWCA VVKKLISILF  780
DGTVDLGQEN CNLVALLDIG LLHRAVRRNC RSMVEFLLNC NPGVNLEKTR SRQKQPDGGQ  840
YLFRPDSVGP GGLTPLHVAA SLDSRENVLD ALTEDPGSVG IKAWKSKRDS SGLTAHDHAC  900
MRGNYSYVLL VEKKLNKKSR NGHVLIDIPG RVIDSSKLGR TSKFVGLESE KRGGECRQCD  960
QKLGYGRRWR SSVRIYRPTM VSIVAIAAVC VCTALLFKSS PEVLYSFRPF RWELLDYGSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301792531084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121125KRRRV
2248254KRRRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100677.10.0PREDICTED: squamosa promoter-binding-like protein 1
TrEMBLA0A075FET00.0A0A075FET0_SALMI; SQUAM
STRINGVIT_05s0020g00700.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12